PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do021234.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GATA
Protein Properties Length: 298aa    MW: 32622.9 Da    PI: 8.4378
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do021234.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.25.5e-19204237134
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                 Cs+C +t+Tp+WR gpdg+ tLCnaCG++y+ ++
  Do021234.1 204 CSHCDSTETPQWRAGPDGPGTLCNACGIRYAMNK 237
                 ******************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.36198236IPR000679Zinc finger, GATA-type
SMARTSM004011.6E-18198252IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.85E-15200261No hitNo description
Gene3DG3DSA:3.30.50.102.7E-15202238IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.24E-15203259No hitNo description
PROSITE patternPS003440204229IPR000679Zinc finger, GATA-type
PfamPF003206.1E-17204238IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MSGGHCNNMH ELSFLYLSPH DFPDVADCDG SCGLVDGGGP CTLHAGLCCP DDSLDTVLEN  60
PHVLAAIDKP HVFTEELLYD LEIAASLPPR HELLPTGRGK EVSESEDSSW TATSSLETKS  120
SLPPPPPPVL RLVVPRRKRD RSVKRGRRLW SLGMPSLPAR HGGNNPNSGS DGKDGGRRNV  180
DGGGVRRRLL GPPRPRNRQT RRACSHCDST ETPQWRAGPD GPGTLCNACG IRYAMNKLLP  240
EYRPSTSPSF RSDKHSNRHR KVVKLREKKV NEKIVDMPPA PPDSGEFMDF CKCISTGQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004954732.12e-80PREDICTED: GATA transcription factor 2-like
TrEMBLK3YZ641e-102K3YZ64_SETIT; Uncharacterized protein
STRINGSi019572m1e-102(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP127772434
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.11e-27GATA transcription factor 4